Structure of PDB 7yhs Chain L Binding Site BS01

Receptor Information
>7yhs Chain L (length=187) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDES
RSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQV
SRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARTLDLPFVTLRSQS
TGQHFRLFIRHGPLQATAEEGGFTCYGLSKGGFVPWF
Ligand information
>7yhs Chain M (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaagaaauucacggcgggcuugauguccgcgucuaccugguucacugcc
guguaggc
..................................................
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yhs Anti-CRISPR protein AcrIF4 inhibits the type I-F CRISPR-Cas surveillance complex by blocking nuclease recruitment and DNA cleavage.
Resolution3.37 Å
Binding residue
(original residue number in PDB)		Q19 R102 Q104 N108 E110 R111 R114 R115 R119 R130 I131 Q153 H154 F155 R156
Binding residue
(residue number reindexed from 1)		Q19 R102 Q104 N108 E110 R111 R114 R115 R119 R130 I131 Q153 H154 F155 R156
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 03:44:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7yhs', asym_id = 'L', bs = 'BS01', title = 'Anti-CRISPR protein AcrIF4 inhibits the type I-F...y blocking nuclease recruitment and DNA cleavage.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7yhs', asym_id='L', bs='BS01', title='Anti-CRISPR protein AcrIF4 inhibits the type I-F...y blocking nuclease recruitment and DNA cleavage.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '7yhs', asym_id = 'L'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='7yhs', asym_id='L')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>