Structure of PDB 7y8j Chain L Binding Site BS01

Receptor Information
>7y8j Chain L (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSQSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGSAPKL
IIYEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYTSSST
LVFGGGTKLTVLGG
Ligand information
>7y8j Chain A (length=6) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVVNQN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y8j Cross-reactive epitopes between HIV and Coronavirus revealed by 3D1
Resolution1.03 Å
Binding residue
(original residue number in PDB)
G-1 Y32 Y93
Binding residue
(residue number reindexed from 1)
G1 Y34 Y95
External links