Structure of PDB 7y3j Chain L Binding Site BS01

Receptor Information
>7y3j Chain L (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLSLPVSLGDQASISCRCSQSLVHRNGNTNLHWYLQKSGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTYVP
LTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3j Structural basis of the 24B3 antibody against the toxic conformer of amyloid beta with a turn at positions 22 and 23.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q27 V30 H31 R32 T97 Y98 V99 L101
Binding residue
(residue number reindexed from 1)		Q27 V30 H31 R32 T97 Y98 V99 L101
External links