Structure of PDB 7w5b Chain L Binding Site BS01

Receptor Information
>7w5b Chain L (length=437) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEW
LDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFL
LDKAARKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGK
KAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIP
FEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQ
HLKRKADVDARKQAIRDAERVKEMKRMHLQKSEELIKKEMITMLHYDLLH
HKEELKKAQDVLVQEMEVVKQGMSHGESLEKRLEINRGHMTTEAKRAAKM
EKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAI
PRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKS
Ligand information
>7w5b Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w5b Mechanism of exon ligation by human spliceosome.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		Y26 R33 N161 K165 K166 R169 K170 K174 R206 L251 R252
Binding residue
(residue number reindexed from 1)		Y23 R30 N146 K150 K151 R154 K155 K159 R191 L236 R237
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0071987 WD40-repeat domain binding
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005662 DNA replication factor A complex
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5b, PDBe:7w5b, PDBj:7w5b
PDBsum7w5b
PubMed35705093
UniProtQ99459|CDC5L_HUMAN Cell division cycle 5-like protein (Gene Name=CDC5L)

[Back to BioLiP]