Structure of PDB 7u8c Chain L Binding Site BS01

Receptor Information
>7u8c Chain L (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLI
AGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVF
GGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVD
WKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSFSCQVTH
EGHTVEKSSSRAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u8c Highly active CAR T cells that bind to a juxtamembrane region of mesothelin and are not blocked by shed mesothelin.
Resolution1.74 Å
Binding residue
(original residue number in PDB)		Y34 N36 A51 G52 N54 N55 W93 W98
Binding residue
(residue number reindexed from 1)		Y34 N36 A51 G52 N54 N55 W93 W98
External links