Structure of PDB 7u09 Chain L Binding Site BS01

Receptor Information
>7u09 Chain L (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YELTQPPSVSVSPGQMARITCSGEALPKKYAYWYQQKGGQFPVLVIYKDT
ERPSGIPERFSGSSSGTIVTLTISGVQPEDEADYYCLSADTSGTWVFGGG
TKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKA
DSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAP
Ligand information
>7u09 Chain A (length=11) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u09 ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L27 K29 K30 Y31 Y33 D50 S89 A90 W96
Binding residue
(residue number reindexed from 1)		L26 K28 K29 Y30 Y32 D49 S88 A89 W95
External links