Structure of PDB 7tcq Chain L Binding Site BS01

Receptor Information
>7tcq Chain L (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIVLTQSPAIMSASPGEKVTISCSATSSVSYIYWYQQRPGSSPKPWIYRT
SNLASGVPVRFSGSGSGTSYSLTISNMEAEDAATYYCQQYQSYPPTFGAG
TKLELKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKID
GSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS
TSPIVKSFNRNE
Ligand information
>7tcq Chain C (length=11) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FKEELDKYFKu
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tcq Vaccine-elicited murine antibody WS6 neutralizes diverse beta-coronaviruses by recognizing a helical stem supersite of vulnerability.
Resolution2.02 Å
Binding residue
(original residue number in PDB)
R50 Y91 S93 Y94 P96
Binding residue
(residue number reindexed from 1)
R49 Y90 S92 Y93 P95
External links