Structure of PDB 7rqr Chain L Binding Site BS01

Receptor Information
>7rqr Chain L (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPSTLSASVGDRVTITCRASQSISRWVAWYQQKAGKAPKLLIYK
ASSLESGVPSRFSGSGSETDFTLTISSLQPDDVATYYCQQYTSYGRTFGQ
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rqr The light chain of the L9 antibody is critical for binding circumsporozoite protein minor repeats and preventing malaria.
Resolution2.23 Å
Binding residue
(original residue number in PDB)		W32 Y91 T92 S93 Y94 R96
Binding residue
(residue number reindexed from 1)		W32 Y91 T92 S93 Y94 R96
External links