Structure of PDB 7p81 Chain L Binding Site BS01

Receptor Information
>7p81 Chain L (length=171) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIPTVIERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEK
EISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGE
KGKRYALPNSEVMIHQPLAAKRILLLRDKLNKVLAERTGQPLEVIERDTD
RDNFKSAEEALEYGLIDKILT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p81 Structural insights into ClpP protease side exit pore-opening by a pH drop coupled with substrate hydrolysis.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		D26 S60 Y62 I92 Y112 L114
Binding residue
(residue number reindexed from 1)		D19 S53 Y55 I85 Y105 L107
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p81, PDBe:7p81, PDBj:7p81
PDBsum7p81
PubMed35593068
UniProtP80244|CLPP_BACSU ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]