Structure of PDB 7oko Chain L Binding Site BS01

Receptor Information
>7oko Chain L (length=216) Species: 1160778 (Salmonella enterica subsp. salamae serovar 58:l,z13,z28:z6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQSPATISLPQGGQFRLSISNTDPNMIFIPGDKVTAITAPGGMLADKRLT
TAGGVLFTSVATRTFTIFVETALGQTFSVVATPVKGEGRVYRLMSAEPPS
RPETRKWETAQAYEKLLISLNRAVLTGDIPDGYGEVKPLSDGIRLPGGFS
VTPLKAWAGDQLRADRYELRNANTWGVALREQDFWKPGVRAVMFDNNAQT
LMGGGRMTVTVIRGNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oko Architecture of the outer-membrane core complex from a conjugative type IV secretion system.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
T58 A59 I60 T61 M66 K70 V78
Binding residue
(residue number reindexed from 1)
T35 A36 I37 T38 M43 K47 V55
Enzymatic activity
Enzyme Commision number ?
External links