Structure of PDB 7o33 Chain L Binding Site BS01

Receptor Information

>7o33 Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVVMTQTPVTLSVNIGQPASISCKSGQSLLHSDGKTYLNWLLQRPGQSPK
RLIYLVSDLDSGVPDRFTSSGSGTDFTLEISRVEAEDLGVYYCWQGTHLP
HTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC

Ligand information

>7o33 Chain P (length=13) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PAPSAAPSAAPSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7o33 Molecular recognition of structurally disordered Pro/Ala-rich sequences (PAS) by antibodies involves an Ala residue at the hot spot of the epitope.
Resolution	1.85 Å
Binding residue (original residue number in PDB)	H31 Y37 N39 R51 Y54 W94 G96 H101
Binding residue (residue number reindexed from 1)	H31 Y37 N39 R51 Y54 W94 G96 H101

External links

PDB	RCSB:7o33, PDBe:7o33, PDBj:7o33
PDBsum	7o33
PubMed	34161780

[Back to BioLiP]