Structure of PDB 7o2z Chain L Binding Site BS01

Receptor Information

>7o2z Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIELSQSPSSLAVSVGEKVTLSCKSSQSLLYSNNQKNYLAWYQQKPGQSP
KLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYNY
PTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC

Ligand information

>7o2z Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

APAPAAPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7o2z Molecular recognition of structurally disordered Pro/Ala-rich sequences (PAS) by antibodies involves an Ala residue at the hot spot of the epitope.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	Y31 Y38 Y98 N99
Binding residue (residue number reindexed from 1)	Y31 Y38 Y98 N99

External links

PDB	RCSB:7o2z, PDBe:7o2z, PDBj:7o2z
PDBsum	7o2z
PubMed	34161780

[Back to BioLiP]