Structure of PDB 7nw3 Chain L Binding Site BS01

Receptor Information
>7nw3 Chain L (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYRGNQMNYLAWYQQKPGQSP
KLLIYWASTRESGVPDRFTGSGSGTEFTLTISSVKAEDLTVYYCQQYYTY
PRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDI
NVKERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nw3 X-ray crystallographic studies of RoAb13 bound to PIYDIN, a part of the N-terminal domain of C-C chemokine receptor 5.
Resolution3.20001 Å
Binding residue
(original residue number in PDB)		D1 Q27 Y98 T99 Y100
Binding residue
(residue number reindexed from 1)		D1 Q27 Y98 T99 Y100
External links