Structure of PDB 7lkb Chain L Binding Site BS01

Receptor Information
>7lkb Chain L (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQSPDSLAVSLGERATINCKSSQNILYSSNNKNYLAWYQQKPGQAP
KLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCHQYYSS
PLTFGGGTKVEIKRADRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP
REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV
YACEVTHQGLSSPVTKSFNRG
Ligand information
>7lkb Chain A (length=15) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lkb Vaccination in a humanized mouse model elicits highly protective PfCSP-targeting anti-malarial antibodies.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y27D K30 Y32 Y49 W50 Y92 S93 S94
Binding residue
(residue number reindexed from 1)		Y31 K36 Y38 Y55 W56 Y98 S99 S100
External links