Structure of PDB 7lfd Chain L Binding Site BS01

Receptor Information

>7lfd Chain L (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQSPDSLSASVGETVTITCGASENIYGALNWYQRKQGKSPQLLIYG
ATNLADGMSSRFSGSRSGRQYSLKISSLHPDDVATYYCQNALSMPYTFGG
GTNLETKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC

Ligand information

>7lfd Chain A (length=17) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EDNIRRLRALADGVQKV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7lfd Structures of the ApoL1 and ApoL2 N-terminal domains reveal a non-classical four-helix bundle motif.
Resolution	2.157 Å
Binding residue (original residue number in PDB)	Y30 R66 L92 S93 M94
Binding residue (residue number reindexed from 1)	Y30 R66 L92 S93 M94

External links

PDB	RCSB:7lfd, PDBe:7lfd, PDBj:7lfd
PDBsum	7lfd
PubMed	34316015

[Back to BioLiP]