Structure of PDB 7jsl Chain L Binding Site BS01

Receptor Information
>7jsl Chain L (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMN
YDKLSRALRYYYNKRILHKTKGKRFTYKFNFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jsl Structural Insight into the DNA Binding Function of Transcription Factor ERF.
Resolution4.51 Å
Binding residue
(original residue number in PDB)		R83 R86 Y89 K96
Binding residue
(residue number reindexed from 1)		R56 R59 Y62 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7jsl, PDBe:7jsl, PDBj:7jsl
PDBsum7jsl
PubMed33175491
UniProtP50548|ERF_HUMAN ETS domain-containing transcription factor ERF (Gene Name=ERF)

[Back to BioLiP]