Structure of PDB 7dvq Chain L Binding Site BS01

Receptor Information
>7dvq Chain L (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSI
KKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAA
Q
Ligand information
>7dvq Chain F (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uguuguaugaaaggagagaagguuagcacuccccuugacaaggauggaag
aggccggccu
............................<<<<<<<<...>>>>..>>>.>
<<<<<>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dvq Structure of the activated human minor spliceosome.
Resolution2.89 Å
Binding residue
(original residue number in PDB)		R33 S36
Binding residue
(residue number reindexed from 1)		R25 S28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0071987 WD40-repeat domain binding
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005662 DNA replication factor A complex
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dvq, PDBe:7dvq, PDBj:7dvq
PDBsum7dvq
PubMed33509932
UniProtQ99459|CDC5L_HUMAN Cell division cycle 5-like protein (Gene Name=CDC5L)

[Back to BioLiP]