Structure of PDB 7bxv Chain L Binding Site BS01

Receptor Information
>7bxv Chain L (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLSLTVSLGDQASISCRSSQSLVHSNGNAYLHWYLQKPGQSPK
VLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP
YTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bxv APOE epsilon 4 allele advances the age-dependent decline of amyloid beta clearance in the human cortex.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		H31 Y37 K55 S96 T97 Y101
Binding residue
(residue number reindexed from 1)		H31 Y37 K55 S96 T97 Y101
External links