Structure of PDB 7blo Chain L Binding Site BS01

Receptor Information
>7blo Chain L (length=155) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRV
KTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPF
RGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKS
YTPSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7blo Architecture and mechanism of metazoan retromer:SNX3 tubular coat assembly.
Resolution9.5 Å
Binding residue
(original residue number in PDB)
V88 H132
Binding residue
(residue number reindexed from 1)
V85 H129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0010314 phosphatidylinositol-5-phosphate binding
GO:0019903 protein phosphatase binding
GO:0032266 phosphatidylinositol-3-phosphate binding
GO:0035091 phosphatidylinositol binding
GO:0070273 phosphatidylinositol-4-phosphate binding
GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
GO:1901981 phosphatidylinositol phosphate binding
GO:1905394 retromer complex binding
Biological Process
GO:0009617 response to bacterium
GO:0010324 membrane invagination
GO:0010976 positive regulation of neuron projection development
GO:0015031 protein transport
GO:0022615 protein to membrane docking
GO:0030111 regulation of Wnt signaling pathway
GO:0032456 endocytic recycling
GO:0034499 late endosome to Golgi transport
GO:0042177 negative regulation of protein catabolic process
GO:0046597 negative regulation of viral entry into host cell
GO:0050765 negative regulation of phagocytosis
GO:0051224 negative regulation of protein transport
GO:0070676 intralumenal vesicle formation
GO:2000642 negative regulation of early endosome to late endosome transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0030136 clathrin-coated vesicle
GO:0030904 retromer complex
GO:0031901 early endosome membrane
GO:0032009 early phagosome
GO:0045335 phagocytic vesicle
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7blo, PDBe:7blo, PDBj:7blo
PDBsum7blo
PubMed33762348
UniProtO60493|SNX3_HUMAN Sorting nexin-3 (Gene Name=SNX3)

[Back to BioLiP]