Structure of PDB 6zvf Chain L Binding Site BS01

Receptor Information
>6zvf Chain L (length=219) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPVSLSLAIGQPASISCKSSQSLVHSDGKTYLSWILQRPGQSPK
GLIYLVSKLDSGVPDRFSGSGSETEFTLKISRVEAEDLGVYYCWQATHFP
LTFGSGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zvf Effective rational humanization of a PASylated anti-galectin-3 Fab for the sensitive PET imaging of thyroid cancer in vivo.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		H27D Y32 A91 T92 H93 F94 L96
Binding residue
(residue number reindexed from 1)		H31 Y37 A96 T97 H98 F99 L101
External links