Structure of PDB 6xlz Chain L Binding Site BS01

Receptor Information
>6xlz Chain L (length=214) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVFTQPHSVSGSPGQTVTISCTRSSGSLDSEYVQWYQQRPGRAPTIVIY
RDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSADDSYNW
VFGGGTRLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV
THEGSTVEKTVAPT
Ligand information
>6xlz Chain P (length=20) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDIVPLEEERKGNSSKYRLI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xlz Structurally related but genetically unrelated antibody lineages converge on an immunodominant HIV-1 Env neutralizing determinant following trimer immunization.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D29 E31 Y32 R50 D51 Y95 W96
Binding residue
(residue number reindexed from 1)		D30 E32 Y33 R51 D52 Y98 W100
External links