Structure of PDB 6xli Chain L Binding Site BS01

Receptor Information

>6xli Chain L (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIKMTQSPSSMYASLGERVTITCKASQDINRYLNWFQQKPGKSPKTLIYR
ANRLLDGVPSRFSGSGSGQDYSLTISSLDYEDMGIYYCLQYDEFPLTFGD
GTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE

Ligand information

>6xli Chain P (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRTPSLPTPPTRE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xli Discovery and Functional Characterization of hPT3, a Humanized Anti-Phospho Tau Selective Monoclonal Antibody.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y32 Y91 D92 E93 F94
Binding residue (residue number reindexed from 1)	Y32 Y91 D92 E93 F94

External links

PDB	RCSB:6xli, PDBe:6xli, PDBj:6xli
PDBsum	6xli
PubMed	32894244

[Back to BioLiP]