Structure of PDB 6x8s Chain L Binding Site BS01

Receptor Information
>6x8s Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLTLSVTIGQPASISCKSSQSLLYSDGKTYLNWLLQRPGQSPK
RLISLVSELDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFP
RTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
Ligand information
>6x8s Chain P (length=13) Species: 5823 (Plasmodium berghei ANKA) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPNANDPPPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x8s Structural ordering of the Plasmodium berghei circumsporozoite protein repeats by inhibitory antibody 3D11.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y27D Y32 N34 R46 S49 L50 E53 W89 G91 R96
Binding residue
(residue number reindexed from 1)		Y31 Y37 N39 R51 S54 L55 E58 W94 G96 R101
External links