Structure of PDB 6x1v Chain L Binding Site BS01

Receptor Information
>6x1v Chain L (length=215) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLTQTPSFTSAAVGGTVTINCQSSQSVWRNKNLAWYQQKPGQPPKRLIY
AIATLDSGVPSRFSGSGSGTQFTLTISDVQCDDAATYYCVGHYGSENDAY
YAFGGGTEVVVKDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVT
WEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVT
QGTTSVVQSFNRGDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1v Structural basis for differential recognition of phosphohistidine-containing peptides by 1-pHis and 3-pHis monoclonal antibodies.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		W28 R29 H91 G93 S94 E95 D95B A95C Y96
Binding residue
(residue number reindexed from 1)		W29 R30 H92 G94 S95 E96 D98 A99 Y101
External links