Structure of PDB 6wj6 Chain L Binding Site BS01

Receptor Information
>6wj6 Chain L (length=31) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQPVELNRTSLYLGLLLVAVLGILFSSYFFN
Ligand information
>6wj6 Chain M (length=29) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QVNNLGFIASILFVLVPTVFLLILFIQTG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wj6 Cryo-EM Structure of Monomeric Photosystem II from Synechocystis sp. PCC 6803 Lacking the Water-Oxidation Complex
Resolution2.58 Å
Binding residue
(original residue number in PDB)		L14 L19 G22 V26 L29 F37 F38
Binding residue
(residue number reindexed from 1)		L6 L11 G14 V18 L21 F29 F30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wj6, PDBe:6wj6, PDBj:6wj6
PDBsum6wj6
PubMed
UniProtQ55354|PSBL_SYNY3 Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]