Structure of PDB 6w05 Chain L Binding Site BS01

Receptor Information

>6w05 Chain L (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QIVMTQSPATVSVSPGERATLSCRASRSVTSKLAWYQQKPGQAPRLLIYG
ASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYFCQQYNNGFTFGPG
TKVDFKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGE

Ligand information

>6w05 Chain P (length=8) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPNANPNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6w05 Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution	2.516 Å
Binding residue (original residue number in PDB)	Y91 N92 N93 G94
Binding residue (residue number reindexed from 1)	Y91 N92 N93 G94

External links

PDB	RCSB:6w05, PDBe:6w05, PDBj:6w05
PDBsum	6w05
PubMed	33594061

[Back to BioLiP]