Structure of PDB 6w00 Chain L Binding Site BS01

Receptor Information

>6w00 Chain L (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQSPSTLSASVGDRVTITCRASQSVSTSLAWYQQKPGKAPNLLIYQ
ASTLYRGVPSRFSGSGSGTEFTLTIGSLQPDDFATYYCQHYNSYSRITFG
QGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGEC

Ligand information

>6w00 Chain P (length=8) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPNANPNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6w00 Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution	1.853 Å
Binding residue (original residue number in PDB)	Y91 S93 Y94 I96
Binding residue (residue number reindexed from 1)	Y91 S93 Y94 I97

External links

PDB	RCSB:6w00, PDBe:6w00, PDBj:6w00
PDBsum	6w00
PubMed	33594061

[Back to BioLiP]