Structure of PDB 6vjn Chain L Binding Site BS01

Receptor Information

>6vjn Chain L (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVVFTQPHSVSGSPGQTVTISCTRTSGSIDSEYVQWYQQRPGSAPTIVIY
RDNQRPSGVPDRFSGSIDSSSNSASLAISGLKSEDEADYYCQSSDDSYNW
VFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKASSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAP

Ligand information

>6vjn Chain G (length=19) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DIVPLEEERKGNSSKYRLI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6vjn Structurally related but genetically unrelated antibody lineages converge on an immunodominant HIV-1 Env neutralizing determinant following trimer immunization.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	D29 E31 Y32 D51 Y95 W96
Binding residue (residue number reindexed from 1)	D30 E32 Y33 D52 Y98 W100

External links

PDB	RCSB:6vjn, PDBe:6vjn, PDBj:6vjn
PDBsum	6vjn
PubMed	34559844

[Back to BioLiP]