Structure of PDB 6qdv Chain L Binding Site BS01

Receptor Information
>6qdv Chain L (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Ligand information
>6qdv Chain 5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccgu
ggagaggaacaaccaauuuuuugag
<<<<<<<<<<<........<<<<<<<<...........>>>>>>>>...>
>>>>>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
A90 K93
Binding residue
(residue number reindexed from 1)
A90 K93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]