Structure of PDB 6ppn Chain L Binding Site BS01

Receptor Information
>6ppn Chain L (length=88) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLPLTLLNATQGRPILVELKNGETFNGHLENCDNYMNLTLREVIRTMPDG
DKFFRLPECYIRGNNIKYLRIQDEVLSQVAKQQAQQRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ppn Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		Y35 N37 R62
Binding residue
(residue number reindexed from 1)		Y35 N37 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0030620 U2 snRNA binding
GO:0140691 RNA folding chaperone
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
GO:0034337 RNA folding
GO:1905323 telomerase holoenzyme complex assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005686 U2 snRNP
GO:0005688 U6 snRNP
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0097525 spliceosomal snRNP complex
GO:0097526 spliceosomal tri-snRNP complex
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppn, PDBe:6ppn, PDBj:6ppn
PDBsum6ppn
PubMed32518066
UniProtO14352|LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 (Gene Name=lsm4)

[Back to BioLiP]