Structure of PDB 6p02 Chain L Binding Site BS01

Receptor Information
>6p02 Chain L (length=91) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAITGERGSGVIGINGA
AAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPI
Ligand information
>6p02 Chain I (length=24) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRTMLKSKIHRATVTCADLHYVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p02 The molecular basis of pyrazinamide activity on Mycobacterium tuberculosis PanD.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		D37 L39 G41 E42 Q43 Y58 A91 T92 Y101
Binding residue
(residue number reindexed from 1)		D13 L15 G17 E18 Q19 Y34 A67 T68 Y77
Enzymatic activity
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p02, PDBe:6p02, PDBj:6p02
PDBsum6p02
PubMed31953389
UniProtP9WIL3|PAND_MYCTU Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]