Structure of PDB 6o1l Chain L Binding Site BS01

Receptor Information
>6o1l Chain L (length=66) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPSRPVRLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o1l Architectural principles for Hfq/Crc-mediated regulation of gene expression.
Resolution3.37 Å
Binding residue
(original residue number in PDB)		Y25 G29 I30 K31 L32 Q52 T61
Binding residue
(residue number reindexed from 1)		Y20 G24 I25 K26 L27 Q47 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o1l, PDBe:6o1l, PDBj:6o1l
PDBsum6o1l
PubMed30758287
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]