Structure of PDB 6ni2 Chain L Binding Site BS01

Receptor Information
>6ni2 Chain L (length=107) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY
SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ni2 Structure of an endosomal signaling GPCR-G protein-beta-arrestin megacomplex.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		S31 R67
Binding residue
(residue number reindexed from 1)		S31 R67
External links