Structure of PDB 6n16 Chain L Binding Site BS01

Receptor Information
>6n16 Chain L (length=217) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGHTYVHWYLQKAGQSPQ
LLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQIP
FTFGGGTKVEIKRTVAAPSVFIFPPSEDQVKSGTVSVVCLLNNFYPREAS
VKWKVDGALKTGNSQESVTEQDSKDNTYSLSSTLTLSSTEYQSHKVYACE
VTHQGLSSPVTKSFNRG
Ligand information
>6n16 Chain F (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n16 Antibody Lineages with Vaccine-Induced Antigen-Binding Hotspots Develop Broad HIV Neutralization.
Resolution2.302 Å
Binding residue
(original residue number in PDB)		H30A Y32 H34 Y36 L46 Y49 T91 L92 I94
Binding residue
(residue number reindexed from 1)		H31 Y37 H39 Y41 L51 Y54 T96 L97 I99
External links