Structure of PDB 6lra Chain L Binding Site BS01

Receptor Information
>6lra Chain L (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMEL
KKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKE
QFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSP
SGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFT
CQVTHEGDTVEKSLSPAECL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lra Crystal structure of the human tau PHF core domain VQIINK complexed with the Fab domain of monoclonal antibody Tau2r3.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y31 T32 G95 D96 T97 F102
Binding residue
(residue number reindexed from 1)		Y31 T32 G95 D96 T97 F102
External links