Structure of PDB 6kdi Chain L Binding Site BS01

Receptor Information

>6kdi Chain L (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLMTQTPLSLPVSLGDQASISCRSSQNIVHSGYTYLEWYLQKPGQSPKLL
IYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFRGSHVPTF
GGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKW
KIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATH
KTSTSPIVKSFNRNE

Ligand information

>6kdi Chain A (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6kdi Structural and biochemical basis of the formation of isoaspartate in the complementarity-determining region of antibody 64M-5 Fab.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y32 S92 H93
Binding residue (residue number reindexed from 1)	Y35 S95 H96

External links

PDB	RCSB:6kdi, PDBe:6kdi, PDBj:6kdi
PDBsum	6kdi
PubMed	31811216

[Back to BioLiP]