Structure of PDB 6idg Chain L Binding Site BS01

Receptor Information

>6idg Chain L (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGYTYLEWYLQKPGQSPK
LLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFRGSHVP
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRNE

Ligand information

>6idg Chain A (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6idg Structures of the antibody 64M-5 Fab and its complex with dT(6-4)T indicate induced-fit and high-affinity mechanisms.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y32 S92 H93
Binding residue (residue number reindexed from 1)	Y37 S97 H98

External links

PDB	RCSB:6idg, PDBe:6idg, PDBj:6idg
PDBsum	6idg
PubMed	30713158

[Back to BioLiP]