Structure of PDB 6h0e Chain L Binding Site BS01

Receptor Information

>6h0e Chain L (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVVMTQSPLSLPVTPGEPASISCRSSQSLLHRSGHKYLHWYLQRPGQSPQ
VLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGLYYCMQTLQTP
WTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGE

Ligand information

>6h0e Chain I (length=9) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MVDSPQLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6h0e Enhancement of therapeutic potential of a naturally occurring human antibody targeting a phosphorylated Ser422containing epitope on pathological tau.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	H31 Y37 T99
Binding residue (residue number reindexed from 1)	H31 Y37 T99

External links

PDB	RCSB:6h0e, PDBe:6h0e, PDBj:6h0e
PDBsum	6h0e
PubMed	30001207

[Back to BioLiP]