Structure of PDB 6fy2 Chain L Binding Site BS01

Receptor Information
>6fy2 Chain L (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YELTQPPSVSVAPGTTATITCGGVDIGSTLVHWYQQRPGQAPLLVIYDDS
DRPSGIPERFSGSNSGNMATLTISRVEAGDEADYYCQVWHSTSAVIFGGG
TKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKA
DSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAPT
Ligand information
>6fy2 Chain P (length=22) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIRDKKQEVRALFYRSDIVPLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fy2 Common helical V1V2 conformations of HIV-1 Envelope expose the alpha 4 beta 7 binding site on intact virions.
Resolution2.301 Å
Binding residue
(original residue number in PDB)
G29 S30 T31 L32 D51 W91
Binding residue
(residue number reindexed from 1)
G27 S28 T29 L30 D49 W89
External links