Structure of PDB 6f7t Chain L Binding Site BS01

Receptor Information
>6f7t Chain L (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPKYVMEL
KKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQEEDEAIYICGVGDTIKE
QFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSP
SGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFT
CQVTHEGDTVEKSLSPAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f7t Dissociation of the Dimer of the Intrinsically Disordered Domain of RNase Y upon Antibody Binding.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y31 T32 E34 E49 G91 D92 T93 F95C Y96
Binding residue
(residue number reindexed from 1)		Y31 T32 E34 E49 G95 D96 T97 F102 Y104
External links