Structure of PDB 6db7 Chain L Binding Site BS01

Receptor Information
>6db7 Chain L (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYELTQPPSVSVSPGQTARITCSGDALPKEYAYWYQQKSGQAPVLVIYED
TRRPSGIPERFSGSSSGTMATLTVSGAHVDDEADYYCYSRDTSANQWVFG
GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE
GSTVEKTVAPT
Ligand information
>6db7 Chain P (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKRIHIGPGRAFY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db7 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution2.213 Å
Binding residue
(original residue number in PDB)		L28 E31 Y32 D51 R91
Binding residue
(residue number reindexed from 1)		L27 E30 Y31 D50 R90
External links