Structure of PDB 6db5 Chain L Binding Site BS01

Receptor Information
>6db5 Chain L (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYELTQPPSVSVSPGQTARITCSGDELPKKYAYWYQEKSGQAPVLIIYED
SKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCFSTDSSGDLWVFG
GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE
GSTVEKTVAPT
Ligand information
>6db5 Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKGIAIGPGRTLYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db5 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution2.599 Å
Binding residue
(original residue number in PDB)		L28 P29 K30 K31 Y32 D51 S66 D95A
Binding residue
(residue number reindexed from 1)		L27 P28 K29 K30 Y31 D50 S65 D95
External links