Structure of PDB 6ct7 Chain L Binding Site BS01

Receptor Information
>6ct7 Chain L (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYELTQPPSVSVSPGQTARITCSGEALPMQFAHWYQQRPGKAPVIVVYKD
SERPSGVPERFSGSSSGTTATLTITGVQAEDEADYYCQSPDSTNTYEVFG
GGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE
GSTVEKTVAPTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ct7 Development of an aggregate-selective, human-derived alpha-synuclein antibody BIIB054 that ameliorates disease phenotypes in Parkinson's disease models.
Resolution1.903 Å
Binding residue
(original residue number in PDB)		L27 M29 Q30 F31 H33 Y48 D50
Binding residue
(residue number reindexed from 1)		L27 M29 Q30 F31 H33 Y48 D50
External links