Structure of PDB 6co3 Chain L Binding Site BS01

Receptor Information

>6co3 Chain L (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA
ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGG
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNR

Ligand information

>6co3 Chain Q (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AEFRHD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6co3 Structural and kinetic basis for the selectivity of aducanumab for aggregated forms of amyloid-beta.
Resolution	2.384 Å
Binding residue (original residue number in PDB)	Y32 S91 Y92 S93 T94
Binding residue (residue number reindexed from 1)	Y32 S91 Y92 S93 T94

External links

PDB	RCSB:6co3, PDBe:6co3, PDBj:6co3
PDBsum	6co3
PubMed	29686315

[Back to BioLiP]