Structure of PDB 6cez Chain L Binding Site BS01

Receptor Information
>6cez Chain L (length=212) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLTQTPSAVSAAVGGTVTINCQASQSVYSDNWLGWYQQKPGQPPKLLIY
AASNLASGVPSRFQGSGSGTQFTLTISDLQCDDAATYYCAGGFSPNWAFG
GGTGVVVDGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEV
DGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGT
TSVVQSFNRGDC
Ligand information
>6cez Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKVQKEYALFYKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cez Select gp120 V2 domain specific antibodies derived from HIV and SIV infection and vaccination inhibit gp120 binding to alpha 4 beta 7.
Resolution2.399 Å
Binding residue
(original residue number in PDB)		Y28 N31 W32 G91 F92 S93 W96
Binding residue
(residue number reindexed from 1)		Y29 N32 W33 G92 F93 S94 W97
External links