Structure of PDB 6ce9 Chain L Binding Site BS01

Receptor Information
>6ce9 Chain L (length=30) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
>6ce9 Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ce9 Structure of the insulin receptor-insulin complex by single-particle cryo-EM analysis.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 L11 V18 C19 R22 G23 F24 F25
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 L11 V18 C19 R22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6ce9, PDBe:6ce9, PDBj:6ce9
PDBsum6ce9
PubMed29512653
UniProtP01318|INS_SHEEP Insulin (Gene Name=INS)

[Back to BioLiP]