Structure of PDB 6b5t Chain L Binding Site BS01

Receptor Information
>6b5t Chain L (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLTQPASVSGSPGQSITISCTATSSNVGSFNLVSWYQHHPGKAPKLIIH
EVSKRPSGASNRFSGSKSGNTASLTISGLQAEDEADYYCCSYVGSDTWVF
GGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVA
WKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTH
EGSTVEKTVAPT
Ligand information
>6b5t Chain A (length=13) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANPNANPNANPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b5t A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution2.222 Å
Binding residue
(original residue number in PDB)
G28 S29 E50 Y91 G93 S94
Binding residue
(residue number reindexed from 1)
G29 S30 E51 Y92 G94 S95
External links