Structure of PDB 6b5l Chain L Binding Site BS01

Receptor Information

>6b5l Chain L (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPP
NLLIYWASTRQSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCHQYYSS
PLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA
KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRG

Ligand information

>6b5l Chain A (length=10) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPDPNANPNV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6b5l A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	Y27D Y92 L96
Binding residue (residue number reindexed from 1)	Y31 Y98 L102

External links

PDB	RCSB:6b5l, PDBe:6b5l, PDBj:6b5l
PDBsum	6b5l
PubMed	29554083

[Back to BioLiP]