BioLiP

Receptor Information

>6b47 Chain L (length=189) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLD
ESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYR
QVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRS
QSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

>6b47 Chain M (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cuaagaaauucacggcgggcuugauguccgcgucuaccugguucacugcc
guguaggcag

..................................................
..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6b47 Cryo-EM Structures Reveal Mechanism and Inhibition of DNA Targeting by a CRISPR-Cas Surveillance Complex.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	D12 P13 F15 A18 Q19 R102 V103 Q104 S107 E110 R111 L112 R113 R115 L116 M117 E126 R130 A138 L139 L141 T145 Q149 S150 T151 G152 Q153 H154 F155 R156 F158 R160 H161 T174 C175 K180 G181
Binding residue (residue number reindexed from 1)	D14 P15 F17 A20 Q21 R104 V105 Q106 S109 E112 R113 L114 R115 R117 L118 M119 E128 R132 A140 L141 L143 T147 Q151 S152 T153 G154 Q155 H156 F157 R158 F160 R162 H163 T176 C177 K182 G183

Enzyme Commision number

3.1.-.-

	Molecular Function
GO:0003723	RNA binding
GO:0004519	endonuclease activity
GO:0005515	protein binding

	Biological Process
GO:0043571	maintenance of CRISPR repeat elements
GO:0051607	defense response to virus

PDB	RCSB:6b47, PDBe:6b47, PDBj:6b47
PDBsum	6b47
PubMed	28985564
UniProt	Q02MM2\|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]

Structure of PDB 6b47 Chain L Binding Site BS01