Structure of PDB 6asb Chain L Binding Site BS01

Receptor Information
>6asb Chain L (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQCTAPVL
PHTAVCLLCGEAGKEDTGEEEKFGLSLMECTICNEIVHPGCEGVINAEIP
NCWECPRCTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6asb DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R36 R38 K69 Q70 S71
Binding residue
(residue number reindexed from 1)		R4 R6 K37 Q38 S39
Binding affinityPDBbind-CN: Kd=1.5uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6asb, PDBe:6asb, PDBj:6asb
PDBsum6asb
PubMed29276034
UniProtQ6PCT2|FXL19_HUMAN F-box/LRR-repeat protein 19 (Gene Name=FBXL19)

[Back to BioLiP]